PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000003.1_g00059.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family HB-PHD
Protein Properties Length: 1092aa    MW: 120930 Da    PI: 4.2531
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000003.1_g00059.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox42.79.8e-14941988552
                              SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHH CS
                 Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrR 52 
                               +f ++ +++L+e+F++n+yp+++ +e LA++lgLt rqV  WF N R
  Itr_sc000003.1_g00059.1 941 LRFGEDAIKRLNEAFKENHYPKRNVKESLARELGLTLRQVDKWFGNTR 988
                              5788999***************************************99 PP

2PHD38.62.5e-13522577151
                              SBTTTSS..TCTTSSEEEBSS.SSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                      PHD   1 rCkvCgk..sdeegelvlCdg.CkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                              +C+ Cg+    ++++++lCdg C++ fH+ Cl+++l +e++p g   wlC+ C++k
  Itr_sc000003.1_g00059.1 522 FCAKCGSkdLPADNDIILCDGaCERGFHQLCLEPPLLKEDIPPGdeGWLCPGCDCK 577
                              699***966566********66********************9999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579032.21E-13512580IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.7E-12518577IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.985520577IPR019787Zinc finger, PHD-finger
SMARTSM002492.3E-9522575IPR001965Zinc finger, PHD-type
CDDcd155044.64E-26522574No hitNo description
PfamPF006287.2E-11522577IPR019787Zinc finger, PHD-finger
PROSITE patternPS013590523574IPR019786Zinc finger, PHD-type, conserved site
PROSITE profilePS5007113.685934988IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.9E-14935988IPR009057Homeodomain-like
SMARTSM003891.4E-10936998IPR001356Homeobox domain
SuperFamilySSF466891.97E-12936995IPR009057Homeodomain-like
CDDcd000861.66E-12938988No hitNo description
PfamPF000464.3E-11942988IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 1092 aa     Download sequence    Send to blast
MTETVYSGTG ESNVKCSDPE SVERLTLSDN ILKNSNCESL GENAIEFECQ NRDSEPLGQT  60
MAIRNGNAER KPAETTVAEF ELVEELSPNY ISIDSNQEQK RPEFKDCTEN SKTEQIIFPS  120
GNEATNSTVE YSAEPLQVMP AVSMDSNNEQ KIPSLEDCGQ NSKFEDNVGT SSTIESSIEP  180
PKELPTENIF TDSNLEQKNL PLKNCGFHSN LVMALPSENK DNNFPVQYPA EPPNDVIKNH  240
DFEQLKETQK DAVEIPSEPL GPKSENDENL GERTIVESVC NEVLLPSGDV AVNSSLEQKE  300
SAPEDLTVDS SFKNLELLHE NEEAISIVDH LAELHGDASE NPGQDLSKIC RDSNENSTQL  360
ECADERPTGC SRKRKATLGS PVISTIVLRS RTQEKPKPVE PIHASADDSA TDEKKRKRRK  420
RKHSKQIAVN EFSGIKSHLR YLLSRIKYEQ NLIDAYSAEG WKGQSLEKLK PEKELQRAKS  480
GIFHYKLKIR DLFQRIDTSL SQGKLPESLF DSDGQIDSED IFCAKCGSKD LPADNDIILC  540
DGACERGFHQ LCLEPPLLKE DIPPGDEGWL CPGCDCKVDC TDLLNDLLGT DLSVTDSWEK  600
VFPEEAAAAA SGKQLDDISG LPSDDSDDDD YNPDNPEVEE NVSQDESNSD ENDSSDASFD  660
LETTANDDIL HGLPSEDSED EDFDPDAPDH DEQVMQDSSS SDFSSDSEDF GVVFENNTSP  720
GQDQCEKIKV GGAKQHCLET TANDDILLGL PSEDSEDEDF DPDAPDHDEQ VMQESSSSGF  780
TSDSEDFGVV FENNTSPGQD QCEKIKVGGA KQQSLKDEVS YLLHSSTVLA SGKRQVERLD  840
YKKLHDETYG IASSDSSDED YEDNSAPKRR KKGSDKAALK SSDQSPLDAM DKNFKQNEIE  900
HTANGSASNT ANEIEHTANT ANRSASNMVV SESGSSGKKN LRFGEDAIKR LNEAFKENHY  960
PKRNVKESLA RELGLTLRQV DKWFGNTRWS FYHPSASRKE PIASETPPKS GISPPQMEEA  1020
TPDVQECLKE DVRLMQPETK ETDVKNHTTP ESKTTSNADD QVSNQSSKTQ RSKKRNTQVD  1080
IANSQRARRS NR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1413418KKRKRR
2413420KKRKRRKR
3413421KKRKRRKRK
4414419KRKRRK
5415421RKRRKRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009775281.10.0PREDICTED: pathogenesis-related homeodomain protein
RefseqXP_009775282.10.0PREDICTED: pathogenesis-related homeodomain protein
TrEMBLA0A0V0IXY30.0A0A0V0IXY3_SOLCH; Putative pathogenesis-related homeodomain protein-like
STRINGSolyc01g107410.2.11e-174(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA72202126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19510.11e-81Homeodomain-like protein with RING/FYVE/PHD-type zinc finger domain